General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F0NGA8",
        "id": "F0NGA8_SACI5",
        "source_organism": {
            "taxId": "930945",
            "scientificName": "Saccharolobus islandicus (strain REY15A)",
            "fullName": "Saccharolobus islandicus (strain REY15A)"
        },
        "name": "Methane/phenol/toluene hydroxylase",
        "description": null,
        "length": 376,
        "sequence": "MTRLEDLEWYRRYKQMFGAFKSGVEGDRFFRDYEYRGYKRVWSTWPMLEKKLGRKKPSEYQIVTYALSYWADPRSPTYIYDKGPFELGTEHITQKWYKHFRDNSPFIKPLFERGEWHDYEDPYKLTYWTYNSMADDNETFLDKIYEEIVNTKYDWNLSEEVLELYKNVYDPLRYVFHIMQMESMYLASMAPTSSITNVFIFMGMDHMRRVQRIAQRVKMLDIIYPSLGFGKEARKIFEESPLFQPTREVLEKMLATYDVGESLVAFNLAVKFVLDELILQHLTQQFSKMGDEMIRHIHMSFYNDTLRHRHQAQELFKYAFSKEPSLKDVIKPWLKDWQEMAFKATEGFRDVLKGEYDNTIKQIKKAHSEYLGGIGL",
        "proteome": "UP000002664",
        "gene": "SiRe_0389",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016709",
                "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "eac32d8115c3269a58cf3796b9ba81a9796c0535",
        "counters": {
            "domain_architectures": 3219,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "pirsf": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3219
        }
    }
}