GET /api/protein/unreviewed/F0NGA8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F0NGA8",
"id": "F0NGA8_SACI5",
"source_organism": {
"taxId": "930945",
"scientificName": "Saccharolobus islandicus (strain REY15A)",
"fullName": "Saccharolobus islandicus (strain REY15A)"
},
"name": "Methane/phenol/toluene hydroxylase",
"description": null,
"length": 376,
"sequence": "MTRLEDLEWYRRYKQMFGAFKSGVEGDRFFRDYEYRGYKRVWSTWPMLEKKLGRKKPSEYQIVTYALSYWADPRSPTYIYDKGPFELGTEHITQKWYKHFRDNSPFIKPLFERGEWHDYEDPYKLTYWTYNSMADDNETFLDKIYEEIVNTKYDWNLSEEVLELYKNVYDPLRYVFHIMQMESMYLASMAPTSSITNVFIFMGMDHMRRVQRIAQRVKMLDIIYPSLGFGKEARKIFEESPLFQPTREVLEKMLATYDVGESLVAFNLAVKFVLDELILQHLTQQFSKMGDEMIRHIHMSFYNDTLRHRHQAQELFKYAFSKEPSLKDVIKPWLKDWQEMAFKATEGFRDVLKGEYDNTIKQIKKAHSEYLGGIGL",
"proteome": "UP000002664",
"gene": "SiRe_0389",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016709",
"name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "eac32d8115c3269a58cf3796b9ba81a9796c0535",
"counters": {
"domain_architectures": 3219,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"pirsf": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3219
}
}
}