GET /api/protein/unreviewed/E3HIT2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E3HIT2",
        "id": "E3HIT2_ACHXA",
        "source_organism": {
            "taxId": "762376",
            "scientificName": "Achromobacter xylosoxidans (strain A8)",
            "fullName": "Achromobacter xylosoxidans (strain A8)"
        },
        "name": "RNA-binding protein Hfq",
        "description": [
            "RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and changes in metabolite concentrations. Also binds with high specificity to tRNAs"
        ],
        "length": 78,
        "sequence": "MSNKGQTLQDPFLNTLRKDHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAISTVVPARAVNFQVEVPAE",
        "proteome": null,
        "gene": "hfq",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b5aa170f70ae8709a5abdfd96ed44db114c44905",
        "counters": {
            "domain_architectures": 12013,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "ssf": 1,
                "profile": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 12013
        }
    }
}