HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E3G1Y8",
"id": "E3G1Y8_ENTLS",
"source_organism": {
"taxId": "701347",
"scientificName": "Enterobacter lignolyticus (strain SCF1)",
"fullName": "Enterobacter lignolyticus (strain SCF1)"
},
"name": "Cobalt transport protein CbiM",
"description": [
"Part of the energy-coupling factor (ECF) transporter complex CbiMNOQ involved in cobalt import"
],
"length": 245,
"sequence": "MKLEQQLKQLSFSGLAAALLLMVVPEQAFAMHIMEGFLPPMWALAWWLLFLPCLWYGLVRLRRIVQEDSHQKVLLALCGAFIFVLSALKIPSVTGSCSHPTGVGLAVILFGPGVVAILGAIVLLFQALLLAHGGLTTLGANGMSMAVIGPVVGYMVWKMACRAGIRRDVGVFLCAMLADLVTYFVTSVQLGVAFPDPTAGATGSIVKFMGIFCLTQIPIAIAEGLLTVMIYDQLTKRQLITAQGH",
"proteome": "UP000006872",
"gene": "cbiM",
"go_terms": [
{
"identifier": "GO:0006824",
"name": "cobalt ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009236",
"name": "cobalamin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0043190",
"name": "ATP-binding cassette (ABC) transporter complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0000041",
"name": "transition metal ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0529123993b892b4c99c40ce24cdb0564fe693f7",
"counters": {
"domain_architectures": 8980,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8980
}
}
}