GET /api/protein/unreviewed/E2A920/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E2A920",
        "id": "E2A920_CAMFO",
        "source_organism": {
            "taxId": "104421",
            "scientificName": "Camponotus floridanus",
            "fullName": "Camponotus floridanus (Florida carpenter ant)"
        },
        "name": "Fatty acid desaturase domain-containing protein",
        "description": null,
        "length": 336,
        "sequence": "MYNSTITEYEGNKSRKLTLRTENGKNSILDQPPKENIPAVQPLIWRNIIAIPVLHIITIYLFVTRYNEAKFWTWIFTISYEILGGLGITAGAHRFWAHRSYSATLPLKIMLTCFYCMVGQTHLTKWIRVHRTHHRYTDTSADPHNASRGFFFSHIGWLMVKCHPAVKEGSKNVDMSDIAADPVIRFFDKYYLPIMFSLCFVLPTLVPVYIWNETWIVSIGATISRYLVTLNAAFAVNSFAHIWGTRPYNRNLKATQNPTVSFFTFGEGWHNYHHSFPWDYKAAELSLYRLNLTTAFIDFMAWVGLAYDLKTPSSEMIDKFCAKRGDGMGLLKPNVK",
        "proteome": "UP000000311",
        "gene": "EAG_14686",
        "go_terms": [
            {
                "identifier": "GO:0016717",
                "name": "oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006629",
                "name": "lipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b8c2738eb3d02f13bb1292f93a1ea49688306935",
        "counters": {
            "domain_architectures": 61909,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 61909
        }
    }
}