GET /api/protein/unreviewed/E0VLY2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E0VLY2",
        "id": "E0VLY2_PEDHC",
        "source_organism": {
            "taxId": "121224",
            "scientificName": "Pediculus humanus subsp. corporis",
            "fullName": "Pediculus humanus subsp. corporis (Body louse)"
        },
        "name": "glutathione-specific gamma-glutamylcyclotransferase",
        "description": [
            "Catalyzes the cleavage of glutathione into 5-oxo-L-proline and a Cys-Gly dipeptide. Acts specifically on glutathione, but not on other gamma-glutamyl peptides"
        ],
        "length": 215,
        "sequence": "MWVFGYGSLIWKADFPFKTKLVGYIKGYKRRFYQYSVDHRGRPNKPGRVVTLLPSHSEDTVWGVAYEIYKKDENFVIAHLDYREKTGYKKQLVTFYPTKEVNNKPTGDAEQATTSDVKEELSENLMVEPFKLMIYIGTEDNKWYGGPASIEDIAKQIHESEGPSGTNKEYLFNLADAMRKMAPHVNDEHLFALEKAVLNLELSGEKKEKSFFENN",
        "proteome": "UP000009046",
        "gene": "8229760",
        "go_terms": [
            {
                "identifier": "GO:0061928",
                "name": "glutathione specific gamma-glutamylcyclotransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006751",
                "name": "glutathione catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "d7339725ab49c2b7cf5d94f1d9bf486fc14c811e",
        "counters": {
            "domain_architectures": 10118,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10118
        }
    }
}