HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D4V408",
"id": "D4V408_PHOVU",
"source_organism": {
"taxId": "702446",
"scientificName": "Phocaeicola vulgatus PC510",
"fullName": "Phocaeicola vulgatus PC510"
},
"name": "Large ribosomal subunit protein uL13",
"description": [
"This protein is one of the early assembly proteins of the 50S ribosomal subunit, although it is not seen to bind rRNA by itself. It is important during the early stages of 50S assembly"
],
"length": 153,
"sequence": "MDTLSYKTISANKETAHKEWVVVDATDQVVGRLGSKVAKLLRGKYKPDFTPHADCGDNVIIINADKVKFTGNKWNDKVYLRYTGYPGGQREMTPAQLMKKPNGEEKLLKRVVKGMLPKNRLGAQLLGNLYVYAGSEHKHEAQTPKSIDINSLK",
"proteome": null,
"gene": "rplM",
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cdd933c6972e36df20e8c3059e624fe397bc606f",
"counters": {
"domain_architectures": 36205,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pirsf": 1,
"ncbifam": 1,
"panther": 1,
"pfam": 1,
"hamap": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 36205
}
}
}