GET /api/protein/unreviewed/D2GVW9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D2GVW9",
        "id": "D2GVW9_AILME",
        "source_organism": {
            "taxId": "9646",
            "scientificName": "Ailuropoda melanoleuca",
            "fullName": "Ailuropoda melanoleuca (Giant panda)"
        },
        "name": "4-hydroxyphenylpyruvate dioxygenase",
        "description": [
            "Catalyzes the conversion of 4-hydroxyphenylpyruvic acid to homogentisic acid, one of the steps in tyrosine catabolism"
        ],
        "length": 384,
        "sequence": "QPERGRFLHFHSVTFWVGNAKQAASFYCNKMGFEPLAYKGLETGSREVVSHVIKQGKIVFVFSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKAREQGARIVREPWTEEDKFGKVKLAVLQTYGDTTHTLVEKMNYTGRFLPGFEAPASVDPLLSKLPSCSLEIIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPINEPALGKKKSQIQEYVDYNGGAGVQHIALKTQDIITAIRHLRERGLEFLAVPSTYYKQLREKLKSAKIRVKESIDVLEELKILVDYDEKGYLLQIFTKPMQDRPTLFLEVIQRHNHQGFGAGNFNSLFKAFEEEQDLRGNLTDLETNGILRGM",
        "proteome": null,
        "gene": "PANDA_000905",
        "go_terms": [
            {
                "identifier": "GO:0003868",
                "name": "4-hydroxyphenylpyruvate dioxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016701",
                "name": "oxidoreductase activity, acting on single donors with incorporation of molecular oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009072",
                "name": "aromatic amino acid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9d4762ac7bcee5ba20eeb178cfcc2598948924c4",
        "counters": {
            "domain_architectures": 29624,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "cdd": 2,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 29624
        }
    }
}