General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C9SM63",
        "id": "C9SM63_VERA1",
        "source_organism": {
            "taxId": "526221",
            "scientificName": "Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136)",
            "fullName": "Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt of alfalfa)"
        },
        "name": "Complex III subunit 9",
        "description": null,
        "length": 119,
        "sequence": "MNRSPQRLDGSRVEALGRKVQPGFRSLKPGVAERILASWTVWLGRHLVWVTDLRLGSKLKADAFFKQNFAMLGFVFGAGFAFEMGFNSLTNKYWDHLNRGRQWKDIRGRYAEAAEDDEE",
        "proteome": "UP000008698",
        "gene": "VDBG_05987",
        "go_terms": [
            {
                "identifier": "GO:0006122",
                "name": "mitochondrial electron transport, ubiquinol to cytochrome c",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045275",
                "name": "respiratory chain complex III",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8c0c3c8acf47a0be30d1a133b36f40da3019df9b",
        "counters": {
            "domain_architectures": 3091,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3091
        }
    }
}