GET /api/protein/unreviewed/C5BU60/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C5BU60",
        "id": "C5BU60_TERTT",
        "source_organism": {
            "taxId": "377629",
            "scientificName": "Teredinibacter turnerae (strain ATCC 39867 / T7901)",
            "fullName": "Teredinibacter turnerae (strain ATCC 39867 / T7901)"
        },
        "name": "Acyl carrier protein",
        "description": [
            "Carrier of the growing fatty acid chain in fatty acid biosynthesis"
        ],
        "length": 79,
        "sequence": "MSSSIEERVKKIVAEQLGVKEEEVKNEASFVEDLGADSLDTVELVMALEEEFETEIPDEEAEKITTVQLAIDYINENLA",
        "proteome": "UP000009080",
        "gene": "acpP",
        "go_terms": [
            {
                "identifier": "GO:0006633",
                "name": "fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3c9e8d520e54d5947b224319c71493893473a1da",
        "counters": {
            "domain_architectures": 82947,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "pfam": 1,
                "ncbifam": 5,
                "panther": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 82947
        }
    }
}