General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C4YIM4",
        "id": "C4YIM4_CANAW",
        "source_organism": {
            "taxId": "294748",
            "scientificName": "Candida albicans (strain WO-1)",
            "fullName": "Candida albicans (strain WO-1) (Yeast)"
        },
        "name": "Protein-lysine N-methyltransferase EFM4",
        "description": [
            "S-adenosyl-L-methionine-dependent protein-lysine N-methyltransferase that mono- and dimethylates elongation factor 1-alpha at 'Lys-316'. May play a role in intracellular transport"
        ],
        "length": 240,
        "sequence": "MELVTNKNCYSWNNFYKKEQDNFNENEEDTGECWFDDSDAESKMIQFIIDKLNEEELPEEISSQSVVRFLDLGTGNGHLLFQLSEDINEEYEGDKTFEYTGIDYSPDSVKFASGVAKRKYSELKVNFEQVDLLQESCSFLQNKFDILLDKGTLDAIALNQESLADFNGKIGMDVYASQVEKMMVQGSILLITSCNFTKDELIKIITKDTNLEVWDEINYPSFQFGGVKGSTVVSIAFVRN",
        "proteome": "UP000001429",
        "gene": "EFM4",
        "go_terms": [
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "72adac29d7bbb006482a9dbd2ca877ca7b706717",
        "counters": {
            "domain_architectures": 42273,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 42273
        }
    }
}