GET /api/protein/unreviewed/C4R9A1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C4R9A1",
        "id": "C4R9A1_KOMPG",
        "source_organism": {
            "taxId": "644223",
            "scientificName": "Komagataella phaffii (strain GS115 / ATCC 20864)",
            "fullName": "Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast)"
        },
        "name": "DNA-directed RNA polymerase subunit",
        "description": [
            "DNA-dependent RNA polymerase which catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates"
        ],
        "length": 171,
        "sequence": "MFFLKDLSLILTLHPSYFGPQMNQYLREKLLTDVEGTCTGQFGYIVTVLDGMNIDVGKGRIIPGSGSAEFEVKYRAVVWKPFKGEVVDAIVSNVSPIGFFADVGPLNVFVSTRLIPDNLVYNPSNSPPAYMSNDELITKGSKVRLKVVGTRTDVNEIYAIGSIKEDFLGAI",
        "proteome": "UP000000314",
        "gene": "PAS_chr4_0906",
        "go_terms": [
            {
                "identifier": "GO:0006351",
                "name": "DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006352",
                "name": "DNA-templated transcription initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e4db4dbb98269f99ce1c03bcd6c8ffcb8536af98",
        "counters": {
            "domain_architectures": 4424,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 43,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "cdd": 2,
                "pfam": 2,
                "profile": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4424
        }
    }
}