GET /api/protein/unreviewed/B4MCF6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4MCF6",
        "id": "B4MCF6_DROVI",
        "source_organism": {
            "taxId": "7244",
            "scientificName": "Drosophila virilis",
            "fullName": "Drosophila virilis (Fruit fly)"
        },
        "name": "Nuclear nucleic acid-binding protein C1D",
        "description": [
            "Plays a role in the recruitment of the exosome to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA"
        ],
        "length": 164,
        "sequence": "MAGIIAPSGGNQPFIDCNGQLNDDQLLGIFVNFSASLDVLEKDLHSAIRAHNFRSLSTEEQVKVDTFLVYVNSTLFWMYLKLQGCDLSKHYILHDLRRAREMLAREKQTNSSKAAPRLDIAASKRFIAAGMHTRFVDMEGVMVTEAQYTRSLTEASGSNLQQTI",
        "proteome": "UP000008792",
        "gene": "Dvir\\GJ18423",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8ccb91705975cf955d9c74b06f9eab9d60f32340",
        "counters": {
            "domain_architectures": 7236,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7236
        }
    }
}