HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B0CPC3",
"id": "B0CPC3_LACBS",
"source_organism": {
"taxId": "486041",
"scientificName": "Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686)",
"fullName": "Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) (Bicoloured deceiver)"
},
"name": "V-type proton ATPase subunit C",
"description": [
"Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity",
"Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. Reversibly leaves the enzyme after glucose depletion, causing the catalytic subcomplex V1 to detach from the V0 section"
],
"length": 392,
"sequence": "MPSDQSTWLLAVPQDGFSEGLIQELSPKLRNQTKLPARNLSQLDIPSFKTGTLDSLVSLSEDLPKLDTYFTATVAKTVDTLRNLLNNDPSKLAQHTLVNEKSTDSYLIDNWKWNEGRYGVQKSLRELVDLLNKEMNSIDNAMKSKLNNYNLVKGSLTQMQRKKTGNLSVRSLADFVSADNFIQDSEYLETLLIAVPRTLVKDWNSKYERLAAMVVPRTSTEIASDDEFVLFSVVIFRRVKDEFLQKCREQKFIVRDFVYSEDEIAKQRQELEMAKTTEKELWTELLRLSRTNFSESFQVLVHLKVIRLFVESVLRYGLPSNYMGIVIKPEGKSAKKIFGVLQSQFAYLRPRSNPAVQHGKKGPADEFVGEYQNILDQEFFDFVLYEVPWIVN",
"proteome": "UP000001194",
"gene": "LACBIDRAFT_181261",
"go_terms": [
{
"identifier": "GO:0015078",
"name": "proton transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:1902600",
"name": "proton transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0033180",
"name": "proton-transporting V-type ATPase, V1 domain",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0046961",
"name": "proton-transporting ATPase activity, rotational mechanism",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "04f9902a7715d7f73dd6d34508199823ece24c08",
"counters": {
"domain_architectures": 6098,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"cathgene3d": 3,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6098
}
}
}
