GET /api/protein/unreviewed/A9KU97/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A9KU97",
        "id": "A9KU97_SHEB9",
        "source_organism": {
            "taxId": "399599",
            "scientificName": "Shewanella baltica (strain OS195)",
            "fullName": "Shewanella baltica (strain OS195)"
        },
        "name": "Protoporphyrinogen IX dehydrogenase [quinone]",
        "description": [
            "Catalyzes the 6-electron oxidation of protoporphyrinogen IX to form protoporphyrin IX; under anaerobic conditions uses menaquinone as an electron acceptor, under aerobic conditions uses ubiquinone as an electron acceptor"
        ],
        "length": 183,
        "sequence": "MTRVLVLYFTRGGHTAKIANAIADQLTFSGAKVDLVDINSAAATCINWPDYEVVALGACVLYGTYDKSVFKFIEQHAEALGALPNSFFCVNVVARNPEKRIPENNKYLQKFIALSPWTPADLKIIAGKVDYPSWPWYDRWMIQLIMKMTKGPTDPKSVIDYTDWADVKVYADHLLELVDVTAI",
        "proteome": null,
        "gene": "hemG",
        "go_terms": [
            {
                "identifier": "GO:0004729",
                "name": "oxygen-dependent protoporphyrinogen oxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0010181",
                "name": "FMN binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0070819",
                "name": "menaquinone-dependent protoporphyrinogen oxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006782",
                "name": "protoporphyrinogen IX biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006783",
                "name": "heme biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "73266f6e74446e0121c968373654bd0454ce15cc",
        "counters": {
            "domain_architectures": 8452,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 8452
        }
    }
}