GET /api/protein/unreviewed/A8ADI9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8ADI9",
        "id": "A8ADI9_CITK8",
        "source_organism": {
            "taxId": "290338",
            "scientificName": "Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)",
            "fullName": "Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)"
        },
        "name": "Purine nucleoside phosphorylase",
        "description": [
            "The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta-(deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate"
        ],
        "length": 277,
        "sequence": "MTHTLFSQNPWYSADIIRAHKPDFTPRVAFILGSGLGALAEQIEDAVAISYARLPGFPVSTVHGHAGELVLGNLAGVPVACMKGRGHFYEGRGMTIMTDAIRTLKLLDCELLFCTNAAGSLRPEVGPGSLVALSDHINTMPGTPMVGMNDERFGDRFFSLANAYDADYRAILQRVAGEEGFTLHEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVISARHCGLKVVAVSAITNLAEGLGDVKLSHAQTLAAAELSRQNFINLICGFLRQLA",
        "proteome": "UP000008148",
        "gene": "CKO_00389",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009116",
                "name": "nucleoside metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004731",
                "name": "purine-nucleoside phosphorylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006139",
                "name": "nucleobase-containing compound metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0055086",
                "name": "nucleobase-containing small molecule metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "27552274e8941821ae0d138350daef5fe3adde72",
        "counters": {
            "domain_architectures": 85785,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "pirsf": 1,
                "ncbifam": 3,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 85785
        }
    }
}