HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A8ADI9",
"id": "A8ADI9_CITK8",
"source_organism": {
"taxId": "290338",
"scientificName": "Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)",
"fullName": "Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)"
},
"name": "Purine nucleoside phosphorylase",
"description": [
"The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta-(deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate"
],
"length": 277,
"sequence": "MTHTLFSQNPWYSADIIRAHKPDFTPRVAFILGSGLGALAEQIEDAVAISYARLPGFPVSTVHGHAGELVLGNLAGVPVACMKGRGHFYEGRGMTIMTDAIRTLKLLDCELLFCTNAAGSLRPEVGPGSLVALSDHINTMPGTPMVGMNDERFGDRFFSLANAYDADYRAILQRVAGEEGFTLHEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVISARHCGLKVVAVSAITNLAEGLGDVKLSHAQTLAAAELSRQNFINLICGFLRQLA",
"proteome": "UP000008148",
"gene": "CKO_00389",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009116",
"name": "nucleoside metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004731",
"name": "purine-nucleoside phosphorylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006139",
"name": "nucleobase-containing compound metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0055086",
"name": "nucleobase-containing small molecule metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "27552274e8941821ae0d138350daef5fe3adde72",
"counters": {
"domain_architectures": 85785,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"pirsf": 1,
"ncbifam": 3,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 85785
}
}
}