General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A5W824",
        "id": "A5W824_PSEP1",
        "source_organism": {
            "taxId": "351746",
            "scientificName": "Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)",
            "fullName": "Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)"
        },
        "name": "S-formylglutathione hydrolase",
        "description": [
            "Serine hydrolase involved in the detoxification of formaldehyde"
        ],
        "length": 284,
        "sequence": "MSLDNISCQKSFGGWHKRYRHHSKVLGCDMVFAVYLPPQAEQGEKLPVLYWLSGLTCTDENFMQKAGAQRLAAELGLIIVAPDTSPRGEQVPGDPDGAWDFGLGAGFYLNATQQPWAQHYRMHDYVVEELPALIEAHFPASGERSISGHSMGGHGALVCALRNPGRYRSVSAFSPISNPMDCPWGEKAFSRYLGEDRGRWREWDASVLLAETPAGQCPPLLVDQGDRDDFLEKQLKPEALEQAARKGGHAMTLRMQPGYDHSYYFIASFIEEHLRHHAVALGRV",
        "proteome": null,
        "gene": "Pput_4160",
        "go_terms": [
            {
                "identifier": "GO:0018738",
                "name": "S-formylglutathione hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046294",
                "name": "formaldehyde catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9db87eed00e5bc39adf7846218077296416adf32",
        "counters": {
            "domain_architectures": 63653,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 63653
        }
    }
}