General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A5C7K4",
        "id": "A5C7K4_VITVI",
        "source_organism": {
            "taxId": "29760",
            "scientificName": "Vitis vinifera",
            "fullName": "Vitis vinifera (Grape)"
        },
        "name": "4-hydroxy-4-methyl-2-oxoglutarate aldolase",
        "description": [
            "Catalyzes the aldol cleavage of 4-hydroxy-4-methyl-2-oxoglutarate (HMG) into 2 molecules of pyruvate. Also contains a secondary oxaloacetate (OAA) decarboxylase activity due to the common pyruvate enolate transition state formed following C-C bond cleavage in the retro-aldol and decarboxylation reactions"
        ],
        "length": 166,
        "sequence": "MALVTTAEVCDANPQLIVSGELRALQPVFQIYGRRPVFSGPIVTLKVFEDNVLIREFLEEKGNGRVLVVDGGGSMRCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALNSHPMKANKKGIGEKHVPIAIAGTRISDGEWLYADTDGILISRTELSV",
        "proteome": null,
        "gene": "VITISV_009897",
        "go_terms": [
            {
                "identifier": "GO:0008428",
                "name": "ribonuclease inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051252",
                "name": "regulation of RNA metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7ba918e63a501c46e37074330479cf2ec61ab795",
        "counters": {
            "domain_architectures": 30296,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 2,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 30296
        }
    }
}