GET /api/protein/unreviewed/A5C7K4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A5C7K4",
"id": "A5C7K4_VITVI",
"source_organism": {
"taxId": "29760",
"scientificName": "Vitis vinifera",
"fullName": "Vitis vinifera (Grape)"
},
"name": "4-hydroxy-4-methyl-2-oxoglutarate aldolase",
"description": [
"Catalyzes the aldol cleavage of 4-hydroxy-4-methyl-2-oxoglutarate (HMG) into 2 molecules of pyruvate. Also contains a secondary oxaloacetate (OAA) decarboxylase activity due to the common pyruvate enolate transition state formed following C-C bond cleavage in the retro-aldol and decarboxylation reactions"
],
"length": 166,
"sequence": "MALVTTAEVCDANPQLIVSGELRALQPVFQIYGRRPVFSGPIVTLKVFEDNVLIREFLEEKGNGRVLVVDGGGSMRCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALNSHPMKANKKGIGEKHVPIAIAGTRISDGEWLYADTDGILISRTELSV",
"proteome": null,
"gene": "VITISV_009897",
"go_terms": [
{
"identifier": "GO:0008428",
"name": "ribonuclease inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051252",
"name": "regulation of RNA metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7ba918e63a501c46e37074330479cf2ec61ab795",
"counters": {
"domain_architectures": 30296,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 2,
"pfam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 30296
}
}
}