GET /api/protein/unreviewed/A1DM02/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1DM02",
        "id": "A1DM02_NEOFI",
        "source_organism": {
            "taxId": "331117",
            "scientificName": "Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)",
            "fullName": "Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)"
        },
        "name": "Translocase of outer membrane 40 kDa subunit",
        "description": [
            "Channel-forming protein essential for import of protein precursors into mitochondria"
        ],
        "length": 355,
        "sequence": "MADFLALPSFLVENSAAVALKDAYHSFSERRAALGLSNPGTVDNIAREVQKEVLLSNFMFSGLRADLTKVFGMSPLFRVSHAFSMGGSGNLPPYAFSAMYGTPKVFMQGNFGSDGALAAVFNYRWNPKLVTKTNTQIMAGASQGLLQIDNDYTGDDFSASIKAFNPSCLDGGLTGIFVGSYLQSITPSLALGFEAIWQRQAMNTRPETALSYCARYKANDWIASAQLQAQGVFTASYWRKLSERVEAGVDMNLQFAPNAAAALMGGPSRDGTTSIGAKYDFRASTFRAQVDSAGKVSCLLEKRIAMPISLTFAGEIDQAKQSAKLGLAVSLEIAGEELMEQQEKIEAQGMIPPPF",
        "proteome": "UP000006702",
        "gene": "NFIA_051680",
        "go_terms": [
            {
                "identifier": "GO:0008320",
                "name": "protein transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030150",
                "name": "protein import into mitochondrial matrix",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005741",
                "name": "mitochondrial outer membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b61af2137f24347970cf1481b12e2dc4b115f98c",
        "counters": {
            "domain_architectures": 17869,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17869
        }
    }
}