HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A1DM02",
"id": "A1DM02_NEOFI",
"source_organism": {
"taxId": "331117",
"scientificName": "Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)",
"fullName": "Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)"
},
"name": "Translocase of outer membrane 40 kDa subunit",
"description": [
"Channel-forming protein essential for import of protein precursors into mitochondria"
],
"length": 355,
"sequence": "MADFLALPSFLVENSAAVALKDAYHSFSERRAALGLSNPGTVDNIAREVQKEVLLSNFMFSGLRADLTKVFGMSPLFRVSHAFSMGGSGNLPPYAFSAMYGTPKVFMQGNFGSDGALAAVFNYRWNPKLVTKTNTQIMAGASQGLLQIDNDYTGDDFSASIKAFNPSCLDGGLTGIFVGSYLQSITPSLALGFEAIWQRQAMNTRPETALSYCARYKANDWIASAQLQAQGVFTASYWRKLSERVEAGVDMNLQFAPNAAAALMGGPSRDGTTSIGAKYDFRASTFRAQVDSAGKVSCLLEKRIAMPISLTFAGEIDQAKQSAKLGLAVSLEIAGEELMEQQEKIEAQGMIPPPF",
"proteome": "UP000006702",
"gene": "NFIA_051680",
"go_terms": [
{
"identifier": "GO:0008320",
"name": "protein transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030150",
"name": "protein import into mitochondrial matrix",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005741",
"name": "mitochondrial outer membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b61af2137f24347970cf1481b12e2dc4b115f98c",
"counters": {
"domain_architectures": 17869,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17869
}
}
}