HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7J8FIG7",
"id": "A0A7J8FIG7_ROUAE",
"source_organism": {
"taxId": "9407",
"scientificName": "Rousettus aegyptiacus",
"fullName": "Rousettus aegyptiacus (Egyptian fruit bat)"
},
"name": "Trifunctional enzyme subunit beta, mitochondrial",
"description": [
"Mitochondrial trifunctional enzyme catalyzes the last three of the four reactions of the mitochondrial beta-oxidation pathway. The mitochondrial beta-oxidation pathway is the major energy-producing process in tissues and is performed through four consecutive reactions breaking down fatty acids into acetyl-CoA. Among the enzymes involved in this pathway, the trifunctional enzyme exhibits specificity for long-chain fatty acids. Mitochondrial trifunctional enzyme is a heterotetrameric complex composed of two proteins, the trifunctional enzyme subunit alpha/HADHA carries the 2,3-enoyl-CoA hydratase and the 3-hydroxyacyl-CoA dehydrogenase activities, while the trifunctional enzyme subunit beta/HADHB described here bears the 3-ketoacyl-CoA thiolase activity"
],
"length": 478,
"sequence": "MTSILTYTLKNLSSPSKRALRFSVRPLSCSSQLRTAPAVQTKSKKTLAKANVRNVVVVDGVRIPFLLSGTSYKDLMAHDLARAALSGLLHRTNVPKEVIDYIVFGTVIQEVKTSNVAREHDHFIHCFRKASLGAGFSDKTPAHTVTMACISSNQAMTTAVGLIAAGQSDVVVAGGVELMSDIPIRHSRKMRRMMLDLNKAKTLGQRLSLISKFRLDFLAPELISVSEFSTNETMGHSADRLAAAFSVSRLEQDEYALRSHSLAKKAQDEGLLSDIVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMAEEKALAMGYKPKAYLRDFLYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDVFEFHEAFSGQILANFKAMDSDWFSQNYMGRKTKIGSPPLEKFNKWGGSLSLGHPFGATGCRLVITAANRLQKEGGQYALVAACAAGGQVAML",
"proteome": "UP000593571",
"gene": "HJG63_006106",
"go_terms": [
{
"identifier": "GO:0016746",
"name": "acyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016747",
"name": "acyltransferase activity, transferring groups other than amino-acyl groups",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "22ac5442f852b2fb09958cfc4b5d4345c679ae38",
"counters": {
"domain_architectures": 119306,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 2,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 119306
}
}
}