GET /api/protein/unreviewed/A0A7J8FIG7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J8FIG7",
        "id": "A0A7J8FIG7_ROUAE",
        "source_organism": {
            "taxId": "9407",
            "scientificName": "Rousettus aegyptiacus",
            "fullName": "Rousettus aegyptiacus (Egyptian fruit bat)"
        },
        "name": "Trifunctional enzyme subunit beta, mitochondrial",
        "description": [
            "Mitochondrial trifunctional enzyme catalyzes the last three of the four reactions of the mitochondrial beta-oxidation pathway. The mitochondrial beta-oxidation pathway is the major energy-producing process in tissues and is performed through four consecutive reactions breaking down fatty acids into acetyl-CoA. Among the enzymes involved in this pathway, the trifunctional enzyme exhibits specificity for long-chain fatty acids. Mitochondrial trifunctional enzyme is a heterotetrameric complex composed of two proteins, the trifunctional enzyme subunit alpha/HADHA carries the 2,3-enoyl-CoA hydratase and the 3-hydroxyacyl-CoA dehydrogenase activities, while the trifunctional enzyme subunit beta/HADHB described here bears the 3-ketoacyl-CoA thiolase activity"
        ],
        "length": 478,
        "sequence": "MTSILTYTLKNLSSPSKRALRFSVRPLSCSSQLRTAPAVQTKSKKTLAKANVRNVVVVDGVRIPFLLSGTSYKDLMAHDLARAALSGLLHRTNVPKEVIDYIVFGTVIQEVKTSNVAREHDHFIHCFRKASLGAGFSDKTPAHTVTMACISSNQAMTTAVGLIAAGQSDVVVAGGVELMSDIPIRHSRKMRRMMLDLNKAKTLGQRLSLISKFRLDFLAPELISVSEFSTNETMGHSADRLAAAFSVSRLEQDEYALRSHSLAKKAQDEGLLSDIVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMAEEKALAMGYKPKAYLRDFLYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDVFEFHEAFSGQILANFKAMDSDWFSQNYMGRKTKIGSPPLEKFNKWGGSLSLGHPFGATGCRLVITAANRLQKEGGQYALVAACAAGGQVAML",
        "proteome": "UP000593571",
        "gene": "HJG63_006106",
        "go_terms": [
            {
                "identifier": "GO:0016746",
                "name": "acyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016747",
                "name": "acyltransferase activity, transferring groups other than amino-acyl groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "22ac5442f852b2fb09958cfc4b5d4345c679ae38",
        "counters": {
            "domain_architectures": 119306,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 119306
        }
    }
}