GET /api/protein/unreviewed/A0A6P8PAL7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P8PAL7",
        "id": "A0A6P8PAL7_GEOSA",
        "source_organism": {
            "taxId": "260995",
            "scientificName": "Geotrypetes seraphini",
            "fullName": "Geotrypetes seraphini (Gaboon caecilian)"
        },
        "name": "Synaptophysin",
        "description": [
            "Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity"
        ],
        "length": 290,
        "sequence": "MYDSCRMGRREDKRLFSIFAFATCGSYSGEFRLSVECANKSLSNLNIDVDFSYPFRLHQVYFNAPSCKNTELSKVFLVGDYSSSAEFFVTIAVFSFLYSLAALVVYCFLQNKYRENNKGPMIDCIVTAIFAFMWLVSSSAWAKGLSDVKLATDPENVIKNMHVCKQEGVQCKELHDPVMSGLNTSVVFGFLNFIIWVGNVWFAFKETGWTAPFMRYPPTTQEKQPAPDSYGQSYNQGPGYGQQDTYGQQGGYQPDYNQQGYGQQPADYSQQGYGQGGYGQAVPTSFSNQM",
        "proteome": "UP000515159",
        "gene": "SYP",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0008021",
                "name": "synaptic vesicle",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5f756213ff67938a2550c46f796f6b727ea6a502",
        "counters": {
            "domain_architectures": 28562,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28562
        }
    }
}