GET /api/protein/unreviewed/A0A6P3WAF3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3WAF3",
"id": "A0A6P3WAF3_CLUHA",
"source_organism": {
"taxId": "7950",
"scientificName": "Clupea harengus",
"fullName": "Clupea harengus (Atlantic herring)"
},
"name": "tRNA N(3)-cytidine methyltransferase",
"description": [
"S-adenosyl-L-methionine-dependent methyltransferase that mediates N(3)-methylcytidine modification of residue 32 of the tRNA anticodon loop of tRNA(Ser), including tRNA(Ser)(UGA) and tRNA(Ser)(GCU). Interaction with SARS1/SerRS is required for N(3)-methylcytidine methylation"
],
"length": 288,
"sequence": "MESVETFVDAAGIESPVRTDDYGVRILSQDEMDRLKDDRVVSEYKQQKLEKEAQKNWDLFYKRNTTNFFKDRHWTTREFEELKACRQFETQKLVLLEAGCGVGNCIFPLLKEDLNIFVYACDFSPRAVEFVKQNSLYSPERCLAFQCDLTKDDLRDNISAESVDAATLIFVLSAIHPDKMQHALENLFRVLKPGGVVLFRDYGLYDHAMLRFKSGNKLGENFYVRQDGTRSYFFSKELLTKLFHDAGFESMVNDYVLRETVNKKEGLCVPRVFLQSKFRRPPTLNNQV",
"proteome": "UP000515152",
"gene": "mettl6",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c043aa35505ceaded7954fe53dbc11785f5f9abb",
"counters": {
"domain_architectures": 25086,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 25086
}
}
}