GET /api/protein/unreviewed/A0A6P3IG26/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P3IG26",
        "id": "A0A6P3IG26_BISBB",
        "source_organism": {
            "taxId": "43346",
            "scientificName": "Bison bison bison",
            "fullName": "Bison bison bison (North American plains bison)"
        },
        "name": "Suppressor of cytokine signaling 6",
        "description": [
            "SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. May be a substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Regulates KIT degradation by ubiquitination of the tyrosine-phosphorylated receptor"
        ],
        "length": 370,
        "sequence": "MKKISLKTFRKSFNLSKSKEDAEFMVVQQPALASDFGKEESLFGSCYGKEMAGCELHGEDEKGGGKNRAKSESLMGTLKRRLSAKQKAKGKGGAAAGGAADEDTFSSSSAPLVFKDARAPRPMRSTSLRSHLPSPRAGPDDGPPLSPLLPPLQTDPSQRTFTGLAGPDAHAADSVRCHLNFDPTSAPGVARVYDSVQSSGPLAVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY",
        "proteome": "UP000515208",
        "gene": "SOCS6",
        "go_terms": [
            {
                "identifier": "GO:0016567",
                "name": "protein ubiquitination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0040008",
                "name": "regulation of growth",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0035556",
                "name": "intracellular signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e16098dee2ddb77b6a79a81058967a7deadb45c6",
        "counters": {
            "domain_architectures": 6301,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 2,
                "ssf": 2,
                "smart": 3,
                "pfam": 2,
                "profile": 2,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6301
        }
    }
}