GET /api/protein/unreviewed/A0A6P3IG26/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3IG26",
"id": "A0A6P3IG26_BISBB",
"source_organism": {
"taxId": "43346",
"scientificName": "Bison bison bison",
"fullName": "Bison bison bison (North American plains bison)"
},
"name": "Suppressor of cytokine signaling 6",
"description": [
"SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. May be a substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Regulates KIT degradation by ubiquitination of the tyrosine-phosphorylated receptor"
],
"length": 370,
"sequence": "MKKISLKTFRKSFNLSKSKEDAEFMVVQQPALASDFGKEESLFGSCYGKEMAGCELHGEDEKGGGKNRAKSESLMGTLKRRLSAKQKAKGKGGAAAGGAADEDTFSSSSAPLVFKDARAPRPMRSTSLRSHLPSPRAGPDDGPPLSPLLPPLQTDPSQRTFTGLAGPDAHAADSVRCHLNFDPTSAPGVARVYDSVQSSGPLAVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY",
"proteome": "UP000515208",
"gene": "SOCS6",
"go_terms": [
{
"identifier": "GO:0016567",
"name": "protein ubiquitination",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0040008",
"name": "regulation of growth",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0035556",
"name": "intracellular signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e16098dee2ddb77b6a79a81058967a7deadb45c6",
"counters": {
"domain_architectures": 6301,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 2,
"ssf": 2,
"smart": 3,
"pfam": 2,
"profile": 2,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6301
}
}
}