GET /api/protein/unreviewed/A0A668SQC7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A668SQC7",
        "id": "A0A668SQC7_OREAU",
        "source_organism": {
            "taxId": "47969",
            "scientificName": "Oreochromis aureus",
            "fullName": "Oreochromis aureus (Israeli tilapia)"
        },
        "name": "Golgin subfamily A member 7",
        "description": [
            "May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS"
        ],
        "length": 135,
        "sequence": "MAETHSLQDMRQQTAITAKVFIQRDYSSGTMCQFQTKFPSELENRIDKQQFEETVRALNNMYAEAEKLGSQSYIEGCLACLTAYTVFLCMETHYEKGAWIAGPFYLELNCSEGSSVMGLSEVGFEENCKVHSGTE",
        "proteome": "UP000472276",
        "gene": "GOLGA7",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "7a3eb0b7bc4d98fbdd94b45c7cc7ad33d91e9cbc",
        "counters": {
            "domain_architectures": 6142,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6142
        }
    }
}