GET /api/protein/unreviewed/A0A665T2L7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A665T2L7",
"id": "A0A665T2L7_ECHNA",
"source_organism": {
"taxId": "173247",
"scientificName": "Echeneis naucrates",
"fullName": "Echeneis naucrates (Live sharksucker)"
},
"name": "Coenzyme Q-binding protein COQ10 START domain-containing protein",
"description": [
"Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes"
],
"length": 249,
"sequence": "MAATAGARRLPMGVRTFSDFLQIATVGSPRLCRAPAPKGCLRQNIRHLSSCGILMTRTPKALCLQDWDTMTAVPQSRNFISLTNKRKEYSERRILGYSMQEMYDVVANVDEYKHFVPWCKKSQTIMKRAGHSKAQLEVGFPPVVERYTSMITSVRPHLVKAVCTDGKLFNHLETIWRFSPGIPGYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRACKVYGPETRIPRELMFHEVHQT",
"proteome": "UP000472264",
"gene": "coq10a",
"go_terms": [
{
"identifier": "GO:0048039",
"name": "ubiquinone binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045333",
"name": "cellular respiration",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e721a5e89043b9d2c22d2ac1cffc7aa3f5fe5e00",
"counters": {
"domain_architectures": 29029,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 29029
}
}
}