GET /api/protein/unreviewed/A0A665T2L7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A665T2L7",
        "id": "A0A665T2L7_ECHNA",
        "source_organism": {
            "taxId": "173247",
            "scientificName": "Echeneis naucrates",
            "fullName": "Echeneis naucrates (Live sharksucker)"
        },
        "name": "Coenzyme Q-binding protein COQ10 START domain-containing protein",
        "description": [
            "Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes"
        ],
        "length": 249,
        "sequence": "MAATAGARRLPMGVRTFSDFLQIATVGSPRLCRAPAPKGCLRQNIRHLSSCGILMTRTPKALCLQDWDTMTAVPQSRNFISLTNKRKEYSERRILGYSMQEMYDVVANVDEYKHFVPWCKKSQTIMKRAGHSKAQLEVGFPPVVERYTSMITSVRPHLVKAVCTDGKLFNHLETIWRFSPGIPGYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRACKVYGPETRIPRELMFHEVHQT",
        "proteome": "UP000472264",
        "gene": "coq10a",
        "go_terms": [
            {
                "identifier": "GO:0048039",
                "name": "ubiquinone binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045333",
                "name": "cellular respiration",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e721a5e89043b9d2c22d2ac1cffc7aa3f5fe5e00",
        "counters": {
            "domain_architectures": 29029,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 29029
        }
    }
}