GET /api/protein/unreviewed/A0A660DC21/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A660DC21",
"id": "A0A660DC21_SERMA",
"source_organism": {
"taxId": "615",
"scientificName": "Serratia marcescens",
"fullName": "Serratia marcescens"
},
"name": "Glucans biosynthesis protein C",
"description": [
"Necessary for the succinyl substitution of periplasmic glucans. Could catalyze the transfer of succinyl residues from the cytoplasmic side of the membrane to the nascent glucan backbones on the periplasmic side of the membrane"
],
"length": 376,
"sequence": "MTKGSKQREFFLDSIRAYLMLLGIPFHLSLIYSSHAWAVNSASPSFSLTVLNDFIHAFRMQVFFVISGYFSYMLYERYERHQWLKVRLERVAIPLLSAIPLITVPQFFMLKYFTDKLNGWDEFSLYQKLNVTVWELVSHLWFLLTLSLLTCACFYLFRKIKRQTREHIPALINRLRGLGNISLCFFIYAVCYSAAHRIILIVAPQLLSNGLFNFVVMETMFYLPFFILGAYAFKYVWLKEIFLRRSPLALLGSLLLFIAYMLNQKLLAHSSYMFELEVVIKTLMGILMTNVVFSFGHNLLNYHSPRITYLVNASLFIYLVHHPLTLIYGAFVTPYIGNNLLGFLLGLLFVFSLAFALYELHKRIPVLRFLFSGKPQ",
"proteome": null,
"gene": "mdoC",
"go_terms": [
{
"identifier": "GO:0016747",
"name": "acyltransferase activity, transferring groups other than amino-acyl groups",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016741",
"name": "transferase activity, transferring one-carbon groups",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fd7b1dc36a046b9148888ac79c05d04e681119a7",
"counters": {
"domain_architectures": 91011,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 91011
}
}
}