General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A5N7MYP3",
        "id": "A0A5N7MYP3_9HYPH",
        "source_organism": {
            "taxId": "2108360",
            "scientificName": "Microvirga tunisiensis",
            "fullName": "Microvirga tunisiensis"
        },
        "name": "Nodulation protein A",
        "description": [
            "N-acyltransferase required for nodulation. Acts in the production of a small, heat-stable compound (Nod) that stimulates mitosis in various plant protoplasts"
        ],
        "length": 210,
        "sequence": "MNIAISSSKGVLSRRSQVRWRLCWENELQLADHTELSTFFRKTYEPAGAFNGKLFEGNRSWARARPELRAMGYDARGVAAHLGLLRRFIKVGGVDLLVAELGLYGVCPDLEGLGISHSIRVMYPVLHQLGVPFAFGTVRPALQNHIARLLGRQALATIVPGTRVRSTQPDVYLDLPPTHVEDVLVVVLPISRPMSDWPTGTIIDRNGPEL",
        "proteome": "UP000403266",
        "gene": "nodA",
        "go_terms": [
            {
                "identifier": "GO:0016746",
                "name": "acyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005829",
                "name": "cytosol",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e521abbe633d92ba1b93fcab3048547fd5dfd518",
        "counters": {
            "domain_architectures": 3387,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "hamap": 1,
                "pfam": 1,
                "ncbifam": 2,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3387
        }
    }
}