General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A5B8NFC8",
        "id": "A0A5B8NFC8_HIRNI",
        "source_organism": {
            "taxId": "42736",
            "scientificName": "Hirudo nipponia",
            "fullName": "Hirudo nipponia (Korean blood-sucking leech)"
        },
        "name": "Hirudin",
        "description": [
            "Hirudin is a potent thrombin-specific protease inhibitor. It forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen"
        ],
        "length": 89,
        "sequence": "MFSLKLFLVLLAVCICVSQANRYSVCTETGQNLCLCEGSDLCSLDNHCEIGSNGKNRCVKGEGKPKKPQSNSDLPEEKYEPIPIEDYDK",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0004867",
                "name": "serine-type endopeptidase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004857",
                "name": "enzyme inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "3320b759c7cd793d4b8b8d7f0c412e2a2f81a268",
        "counters": {
            "domain_architectures": 35,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 35
        }
    }
}