HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A4U1FTQ3",
"id": "A0A4U1FTQ3_MONMO",
"source_organism": {
"taxId": "40151",
"scientificName": "Monodon monoceros",
"fullName": "Monodon monoceros (Narwhal)"
},
"name": "Mitochondrial dicarboxylate carrier",
"description": [
"Catalyzes the electroneutral exchange or flux of physiologically important metabolites such as dicarboxylates (malonate, malate, succinate), inorganic sulfur-containing anions, and phosphate, across the mitochondrial inner membrane. Substrate exchange across the membrane occurs consecutively with one substrate being transported first, then dissociating from the substrate binding site before the second substrate binds for transport in the opposite direction. Does not transport glutathione. Plays an important role in gluconeogenesis, fatty acid metabolism, urea synthesis, and sulfur metabolism, particularly in liver, by supplying the substrates for the different metabolic processes. Regulates fatty acid release from adipocytes, and contributes to systemic insulin sensitivity"
],
"length": 287,
"sequence": "MAAEARVSRWYFGGLASCGAACCTHPLDLVKVHLQTQQEVKLRMTGMALQVVRSDGILALYNGLSASLCRQMTYSLTRFAIYETVRDQVTKGSEGPLPFYKKVLLGSISGCIGGFVGTPADMVNVRMQNDMKLPQNQRRNYAHALDGLYRVAREEGLKKLFSGATMASSRGMLVTVGQLSCYDQAKQLVLSTGYLSDSIFTHFIASFIAGGCATFLCQPLDVLKTRLMNAKGEYQGVLHCAMETAKLGPLAFYKGLVPAGIRLMPHTVLTFVFLEQLRKHFGIKVPS",
"proteome": "UP000694561",
"gene": "SLC25A10",
"go_terms": [
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
"counters": {
"domain_architectures": 125498,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 125498
}
}
}