GET /api/protein/unreviewed/A0A453QAD8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A453QAD8",
        "id": "A0A453QAD8_AEGTS",
        "source_organism": {
            "taxId": "200361",
            "scientificName": "Aegilops tauschii subsp. strangulata",
            "fullName": "Aegilops tauschii subsp. strangulata (Goatgrass)"
        },
        "name": "Uncharacterized protein",
        "description": [
            "Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane. Their precise function is not known"
        ],
        "length": 81,
        "sequence": "MATNSRKSVIMGVVILVLVIHQAQVEAKSCCCSTSGRNCYNACRVTGASRKTCASLCGCKILNKCVRPCDRFNLYPEAGKL",
        "proteome": "UP000015105",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0006952",
                "name": "defense response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "59c4f0c5f8bfb051dd16b34db9340e01200e5e84",
        "counters": {
            "domain_architectures": 573,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 573
        }
    }
}