GET /api/protein/unreviewed/A0A445BHP1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A445BHP1",
        "id": "A0A445BHP1_ARAHY",
        "source_organism": {
            "taxId": "3818",
            "scientificName": "Arachis hypogaea",
            "fullName": "Arachis hypogaea (Peanut)"
        },
        "name": "Queuine tRNA-ribosyltransferase catalytic subunit 1",
        "description": [
            "Catalytic subunit of the queuine tRNA-ribosyltransferase (TGT) that catalyzes the base-exchange of a guanine (G) residue with queuine (Q) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming queuine, allowing a nucleophilic attack on the C1' of the ribose to form the product"
        ],
        "length": 545,
        "sequence": "MASAERQLEEQLREAGNKLLDPPSSVDELLPLLDPPPPQNFRSPLFTLQSTLTPFSSPSRHSLVRFHPVMRNSIAIAVPLRLRPNISNTLPHHKFRPTCFHSHEGHTISCVPYSAPQTKPMALHFEILGRFNRARAAQLTLPHFVCQTPLFMPVGTQGTIKGLTNNELERIGCQIILGNTYHLALRPTSELLEEAGGLHNFMNWPRAMLTDSGGFQMVSLLHLADITEEGVTFQSPVDGKPMLLTPEESIQIQNRIGADIIMALDDVVKTTITGPRIEEAMYRTLRWIDRCIAAHKRPHDQNLFGIVQGGLDPELRDICVKGLVDRNLPGYAIGGLAGGEDKDSFWRVVAQCTAALPEDKPRYVMGVGYPLDIVVCSALGADMYDCVYPTRTARFGTALIPEGVLKLKHRAMADDTRPIDPTCPCMVCKNYTRAYIHCLVTKDAMGSQLLSYHNLYYMMRLSRNLHTSIVEGRFPKFVCDFLQTMFPKGDVPEWVCNAMEVAGIDISSCCAPFPSCQEKYSSDEIGTNDIHMELRLTHTRSVVVY",
        "proteome": "UP000289738",
        "gene": "Ahy_A09g043163",
        "go_terms": [
            {
                "identifier": "GO:0006400",
                "name": "tRNA modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008479",
                "name": "tRNA-guanosine(34) queuine transglycosylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "eafd7fbc2e41b85ce18cb590f0612d798045897d",
        "counters": {
            "domain_architectures": 31634,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 2,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 31634
        }
    }
}