HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A445BHP1",
"id": "A0A445BHP1_ARAHY",
"source_organism": {
"taxId": "3818",
"scientificName": "Arachis hypogaea",
"fullName": "Arachis hypogaea (Peanut)"
},
"name": "Queuine tRNA-ribosyltransferase catalytic subunit 1",
"description": [
"Catalytic subunit of the queuine tRNA-ribosyltransferase (TGT) that catalyzes the base-exchange of a guanine (G) residue with queuine (Q) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming queuine, allowing a nucleophilic attack on the C1' of the ribose to form the product"
],
"length": 545,
"sequence": "MASAERQLEEQLREAGNKLLDPPSSVDELLPLLDPPPPQNFRSPLFTLQSTLTPFSSPSRHSLVRFHPVMRNSIAIAVPLRLRPNISNTLPHHKFRPTCFHSHEGHTISCVPYSAPQTKPMALHFEILGRFNRARAAQLTLPHFVCQTPLFMPVGTQGTIKGLTNNELERIGCQIILGNTYHLALRPTSELLEEAGGLHNFMNWPRAMLTDSGGFQMVSLLHLADITEEGVTFQSPVDGKPMLLTPEESIQIQNRIGADIIMALDDVVKTTITGPRIEEAMYRTLRWIDRCIAAHKRPHDQNLFGIVQGGLDPELRDICVKGLVDRNLPGYAIGGLAGGEDKDSFWRVVAQCTAALPEDKPRYVMGVGYPLDIVVCSALGADMYDCVYPTRTARFGTALIPEGVLKLKHRAMADDTRPIDPTCPCMVCKNYTRAYIHCLVTKDAMGSQLLSYHNLYYMMRLSRNLHTSIVEGRFPKFVCDFLQTMFPKGDVPEWVCNAMEVAGIDISSCCAPFPSCQEKYSSDEIGTNDIHMELRLTHTRSVVVY",
"proteome": "UP000289738",
"gene": "Ahy_A09g043163",
"go_terms": [
{
"identifier": "GO:0006400",
"name": "tRNA modification",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008479",
"name": "tRNA-guanosine(34) queuine transglycosylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "eafd7fbc2e41b85ce18cb590f0612d798045897d",
"counters": {
"domain_architectures": 31634,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 2,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 31634
}
}
}