HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3P9ATR4",
"id": "A0A3P9ATR4_9CICH",
"source_organism": {
"taxId": "106582",
"scientificName": "Maylandia zebra",
"fullName": "Maylandia zebra (zebra mbuna)"
},
"name": "DNA-directed RNA polymerases I, II, and III subunit RPABC5",
"description": [
"DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively"
],
"length": 67,
"sequence": "MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLSHVDLIEKLLNYAPLEK",
"proteome": "UP000265160",
"gene": null,
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003899",
"name": "DNA-directed RNA polymerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006351",
"name": "DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7038d5dbbe25fce9346d9633f5fddfe23d8947e0",
"counters": {
"domain_architectures": 4864,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4864
}
}
}