GET /api/protein/unreviewed/A0A384C6W8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A384C6W8",
"id": "A0A384C6W8_URSMA",
"source_organism": {
"taxId": "29073",
"scientificName": "Ursus maritimus",
"fullName": "Ursus maritimus (Polar bear)"
},
"name": "V-type proton ATPase subunit",
"description": [
"Subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment"
],
"length": 81,
"sequence": "MAYNGLTVPLIVMSVFWGFVGFCVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNETIWYLKYHWP",
"proteome": "UP000261680",
"gene": "ATP6V0E1",
"go_terms": [
{
"identifier": "GO:0046961",
"name": "proton-transporting ATPase activity, rotational mechanism",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:1902600",
"name": "proton transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0033179",
"name": "proton-transporting V-type ATPase, V0 domain",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "5c03a4ebe290c193200d4d70f7cb4785e0ac5155",
"counters": {
"domain_architectures": 3843,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3843
}
}
}