General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A341CQZ6",
        "id": "A0A341CQZ6_NEOAA",
        "source_organism": {
            "taxId": "1706337",
            "scientificName": "Neophocaena asiaeorientalis asiaeorientalis",
            "fullName": "Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)"
        },
        "name": "Biogenesis of lysosome-related organelles complex 1 subunit 6",
        "description": [
            "Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. May play a role in intracellular vesicle trafficking, particularly in the vesicle-docking and fusion process"
        ],
        "length": 172,
        "sequence": "MSVPGPPSLDGVLAGPPDGLEAGGPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFTEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTAKPAKRM",
        "proteome": "UP000252040",
        "gene": "BLOC1S6",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a9c8028288f3a69e54db0bf4c264e51fcf6e1c63",
        "counters": {
            "domain_architectures": 3631,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3631
        }
    }
}