GET /api/protein/unreviewed/A0A2R9BAF2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2R9BAF2",
        "id": "A0A2R9BAF2_PANPA",
        "source_organism": {
            "taxId": "9597",
            "scientificName": "Pan paniscus",
            "fullName": "Pan paniscus (Pygmy chimpanzee)"
        },
        "name": "Calcium-activated potassium channel subunit beta",
        "description": [
            "Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity"
        ],
        "length": 227,
        "sequence": "MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTDRAILLGLAMMVCSIMMYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR",
        "proteome": "UP000240080",
        "gene": "KCNMB2",
        "go_terms": [
            {
                "identifier": "GO:0015269",
                "name": "calcium-activated potassium channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006813",
                "name": "potassium ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5401bad98b52705c09c64b35ab2eb90028a44904",
        "counters": {
            "domain_architectures": 1017,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1017
        }
    }
}