GET /api/protein/unreviewed/A0A2K6M4I4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2K6M4I4",
"id": "A0A2K6M4I4_RHIBE",
"source_organism": {
"taxId": "61621",
"scientificName": "Rhinopithecus bieti",
"fullName": "Rhinopithecus bieti (Black snub-nosed monkey)"
},
"name": "Serine/threonine-protein phosphatase 2A activator",
"description": [
"PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides"
],
"length": 76,
"sequence": "MKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAEASPSDTWGLGISRLGHGQSEKHQPPQPKAAAQLCPDEFGG",
"proteome": "UP000233180",
"gene": null,
"go_terms": [
{
"identifier": "GO:0019211",
"name": "phosphatase activator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "72ff6fad7eb2a23f6de70223ef85ba73d19c8cc3",
"counters": {
"domain_architectures": 6086,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6086
}
}
}