GET /api/protein/unreviewed/A0A2K6JYM2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2K6JYM2",
"id": "A0A2K6JYM2_RHIBE",
"source_organism": {
"taxId": "61621",
"scientificName": "Rhinopithecus bieti",
"fullName": "Rhinopithecus bieti (Black snub-nosed monkey)"
},
"name": "EKC/KEOPS complex subunit TPRKB",
"description": [
"Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. TPRKB acts as an allosteric effector that regulates the t(6)A activity of the complex. TPRKB is not required for tRNA modification"
],
"length": 175,
"sequence": "MQLTYQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISASDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKSLPEITNITEVQKIYKLSSQEESIGTLLDGIICRMSTKDVL",
"proteome": "UP000233180",
"gene": null,
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "fd915e41acd5042efaf0afef90965b3303da1187",
"counters": {
"domain_architectures": 4013,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4013
}
}
}