General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K6BK00",
        "id": "A0A2K6BK00_MACNE",
        "source_organism": {
            "taxId": "9545",
            "scientificName": "Macaca nemestrina",
            "fullName": "Macaca nemestrina (Pig-tailed macaque)"
        },
        "name": "Migration and invasion enhancer 1",
        "description": [
            "Increases cell migration by inducing filopodia formation at the leading edge of migrating cells. Plays a role in regulation of apoptosis, possibly through control of CASP3. May be involved in a redox-related process"
        ],
        "length": 115,
        "sequence": "MSGEPGQTSVAPPPEEVELGSGVRIMVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASKGEPLEKITNSRPPCVIL",
        "proteome": "UP000233120",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "58d4beb6754800c8fb86046e2a7f6dd45ad72275",
        "counters": {
            "domain_architectures": 9371,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9371
        }
    }
}