General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K5V3A4",
        "id": "A0A2K5V3A4_MACFA",
        "source_organism": {
            "taxId": "9541",
            "scientificName": "Macaca fascicularis",
            "fullName": "Macaca fascicularis (Crab-eating macaque)"
        },
        "name": "Thioredoxin domain-containing protein 9",
        "description": [
            "Significantly diminishes the chaperonin TCP1 complex ATPase activity, thus negatively impacts protein folding, including that of actin or tubulin"
        ],
        "length": 226,
        "sequence": "MEADASVDMFSKVLENQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLEALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESKKVVCHFYRDSAFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALVKDGKTQDYVVGFTDLGNTDDFTTESLEWRLGCSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD",
        "proteome": "UP000233100",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "c184e98bae53a420073bcaa179da7ca963727ccd",
        "counters": {
            "domain_architectures": 94304,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 94304
        }
    }
}