GET /api/protein/unreviewed/A0A2K5N1G3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2K5N1G3",
"id": "A0A2K5N1G3_CERAT",
"source_organism": {
"taxId": "9531",
"scientificName": "Cercocebus atys",
"fullName": "Cercocebus atys (Sooty mangabey)"
},
"name": "Urokinase plasminogen activator surface receptor",
"description": [
"Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form"
],
"length": 335,
"sequence": "MGHPLLLPLLLLLHTCVPASWGLRCMQCKSNGDCRVEECALGQDLCRTTIVRVWEEGEELELVKKSCTHSEKTNRTMSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTFSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSSGFHNNDTFHFLKCCNTTKCNEGPILELETLPQNGHQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTYEPKNQSYMVRGCVTASMCQCAHLGDAFSMNHINVSCCTESGCNHPDLDVQYRKAAAPQPGPAHLSLTITLLMTARLWGGTLLWT",
"proteome": "UP000233060",
"gene": "PLAUR",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8161bb5a7a834a6728c042fc5051cf4fb8e0c22b",
"counters": {
"domain_architectures": 547,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cathgene3d": 1,
"cdd": 3,
"ssf": 1,
"smart": 1,
"panther": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 547
}
}
}