GET /api/protein/unreviewed/A0A2K5KW37/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K5KW37",
        "id": "A0A2K5KW37_CERAT",
        "source_organism": {
            "taxId": "9531",
            "scientificName": "Cercocebus atys",
            "fullName": "Cercocebus atys (Sooty mangabey)"
        },
        "name": "Tumor necrosis factor alpha-induced protein 8-like protein 2",
        "description": [
            "Acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. Plays a regulatory role in the Toll-like signaling pathway by determining the strength of LPS-induced signaling and gene expression. Inhibits TCR-mediated T-cell activation and negatively regulate T-cell function to prevent hyperresponsiveness. Also inhibits autolysosome formation via negatively modulating MTOR activation by interacting with RAC1 and promoting the disassociation of the RAC1-MTOR complex. Plays an essential role in NK-cell biology by acting as a checkpoint and displaying an expression pattern correlating with NK-cell maturation process and by negatively regulating NK-cell maturation and antitumor immunity. Mechanistically, suppresses IL-15-triggered mTOR activity in NK-cells"
        ],
        "length": 184,
        "sequence": "MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAVKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL",
        "proteome": "UP000233060",
        "gene": "TNFAIP8L2",
        "go_terms": [
            {
                "identifier": "GO:0042981",
                "name": "regulation of apoptotic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bbc210a4e21397768fbfa09f23e3849e59f1e83e",
        "counters": {
            "domain_architectures": 4005,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4005
        }
    }
}