General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1S3GCF0",
        "id": "A0A1S3GCF0_DIPOR",
        "source_organism": {
            "taxId": "10020",
            "scientificName": "Dipodomys ordii",
            "fullName": "Dipodomys ordii (Ord's kangaroo rat)"
        },
        "name": "Leukotriene C4 synthase",
        "description": [
            "Catalyzes the conjugation of leukotriene A4 with reduced glutathione (GSH) to form leukotriene C4 with high specificity. Can also catalyze the transfer of a glutathionyl group from glutathione (GSH) to 13(S),14(S)-epoxy-docosahexaenoic acid to form maresin conjugate in tissue regeneration 1 (MCTR1), a bioactive lipid mediator that possess potent anti-inflammatory and proresolving actions"
        ],
        "length": 150,
        "sequence": "MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFHVSPPLTTGPPEFERVFRAQVNCSEYFPLFLAMLWVAGIFFHEGAAALCGVVYLFMRLRYFQGYARSPQLRLAPLYASARALWLLVAMAALGLLVHFLPVALRAALLTRLRELWPIA",
        "proteome": "UP000081671",
        "gene": "Ltc4s",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0008047",
                "name": "enzyme activator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006691",
                "name": "leukotriene metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e2cf1f5163a84e238f4e7981be2ccc606dab93d5",
        "counters": {
            "domain_architectures": 28012,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28012
        }
    }
}