GET /api/protein/unreviewed/A0A1L8FHE1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1L8FHE1",
"id": "A0A1L8FHE1_XENLA",
"source_organism": {
"taxId": "8355",
"scientificName": "Xenopus laevis",
"fullName": "Xenopus laevis (African clawed frog)"
},
"name": "Voltage-dependent calcium channel gamma-8 subunit",
"description": [
"Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits"
],
"length": 342,
"sequence": "MEWCEKGVQILMTTVGAFAAFGLMTIAIGTDYWLYARAFICNTTNISSEETPQKDKKDPGGLTHSGLWRICCLEGQKRGVCVNINHFPEDTDYDHDSAEYLLRVVRASSIFPILSAMLLLLGGLCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVYISANAGDPGTKRDDEKKSHYSYGWSFYFGGLSFIIAEVIGVLAVNIYIEKNREAHCKSRTELIKNPSAILRLPSYRFRYRRRSRSSSRSTEPSQSRDTSPVGVKGIPSTDISMYTLSRDTSKANVSSMYNTERGDHSFLQLHNCFPKDSGVTVTVTGPASNTGTLGKDGSNTNTLNRKTTPV",
"proteome": "UP000186698",
"gene": "cacng8.S",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0006816",
"name": "calcium ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "e648976f769facdf79670450e88b05ada3026a70",
"counters": {
"domain_architectures": 34102,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"prints": 2,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 34102
}
}
}