GET /api/protein/unreviewed/A0A1B7SMX3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1B7SMX3",
"id": "A0A1B7SMX3_9ASCO",
"source_organism": {
"taxId": "460523",
"scientificName": "Ogataea polymorpha",
"fullName": "Ogataea polymorpha"
},
"name": "Cap-associated protein CAF20",
"description": [
"Acts as an inhibitor of cap-dependent translation. Competes with eIF4G1 and EAP1 for binding to eIF4E and interferes with the formation of the eIF4F complex, inhibiting translation and stabilizing mRNA"
],
"length": 144,
"sequence": "MVQRYTEEELLALQSHGVLPTGIDLTSFVQLIDDVREALREVDDQGLRRKSFTGFKKRQPKELKQTDEEGWTSFVTPKPKKNAPQEDKQEIKQHTMKVKTSSSKISSGKASVDTRDTIAITQVSKFNAFDALNAEDEAIESDEE",
"proteome": "UP000788993",
"gene": "OGATHE_000642",
"go_terms": [
{
"identifier": "GO:0008190",
"name": "eukaryotic initiation factor 4E binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006413",
"name": "translational initiation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0017148",
"name": "negative regulation of translation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "f9774ca014d30e9cfff1e3db43a7594fd84d2e10",
"counters": {
"domain_architectures": 140,
"entries": 2,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 140
}
}
}