General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1B7SMX3",
        "id": "A0A1B7SMX3_9ASCO",
        "source_organism": {
            "taxId": "460523",
            "scientificName": "Ogataea polymorpha",
            "fullName": "Ogataea polymorpha"
        },
        "name": "Cap-associated protein CAF20",
        "description": [
            "Acts as an inhibitor of cap-dependent translation. Competes with eIF4G1 and EAP1 for binding to eIF4E and interferes with the formation of the eIF4F complex, inhibiting translation and stabilizing mRNA"
        ],
        "length": 144,
        "sequence": "MVQRYTEEELLALQSHGVLPTGIDLTSFVQLIDDVREALREVDDQGLRRKSFTGFKKRQPKELKQTDEEGWTSFVTPKPKKNAPQEDKQEIKQHTMKVKTSSSKISSGKASVDTRDTIAITQVSKFNAFDALNAEDEAIESDEE",
        "proteome": "UP000788993",
        "gene": "OGATHE_000642",
        "go_terms": [
            {
                "identifier": "GO:0008190",
                "name": "eukaryotic initiation factor 4E binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006413",
                "name": "translational initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0017148",
                "name": "negative regulation of translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "f9774ca014d30e9cfff1e3db43a7594fd84d2e10",
        "counters": {
            "domain_architectures": 140,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 140
        }
    }
}