General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A161XBT2",
        "id": "A0A161XBT2_DAUCS",
        "source_organism": {
            "taxId": "79200",
            "scientificName": "Daucus carota subsp. sativus",
            "fullName": "Daucus carota subsp. sativus (Carrot)"
        },
        "name": "Ubiquitin thioesterase OTU",
        "description": [
            "Hydrolase that can remove conjugated ubiquitin from proteins and may therefore play an important regulatory role at the level of protein turnover by preventing degradation"
        ],
        "length": 208,
        "sequence": "MEGTIVRRVIPSDNSCLFNAVGYIMEHDKHKAPELRQVIAATVASDPKKYSEAFLGKPNEEYCAWILNPEKWGGAIELSILAEYYGREIAAYDIQTTRCDLYGQGKNYQERVMLIYDGLHYDALAMSPSDGAPEEFDQTIFAVRNDRTLGPVEGLTLNLVKEQQRKRSYTDTANFTLRCGVCQIGVIGQKEAVQHAEATGHVNFQEYK",
        "proteome": "UP000077755",
        "gene": "DCAR_0623604",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "657d3b69f4b5cf4e700d10390124a772f84d2b9b",
        "counters": {
            "domain_architectures": 1009,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "profile": 1,
                "ssf": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1009
        }
    }
}