GET /api/protein/unreviewed/A0A0Q3M5S5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0Q3M5S5",
"id": "A0A0Q3M5S5_AMAAE",
"source_organism": {
"taxId": "12930",
"scientificName": "Amazona aestiva",
"fullName": "Amazona aestiva (Blue-fronted Amazon parrot)"
},
"name": "SOSS complex subunit C",
"description": [
"Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs)"
],
"length": 104,
"sequence": "MAANPSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALARSPLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLEAE",
"proteome": "UP000051836",
"gene": "AAES_119982",
"go_terms": [
{
"identifier": "GO:0006281",
"name": "DNA repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006974",
"name": "DNA damage response",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0070876",
"name": "SOSS complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "0bfa69b9358e2f5f65c4113428e8e73b4178c569",
"counters": {
"domain_architectures": 1296,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1296
}
}
}