General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0Q3M5S5",
        "id": "A0A0Q3M5S5_AMAAE",
        "source_organism": {
            "taxId": "12930",
            "scientificName": "Amazona aestiva",
            "fullName": "Amazona aestiva (Blue-fronted Amazon parrot)"
        },
        "name": "SOSS complex subunit C",
        "description": [
            "Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs)"
        ],
        "length": 104,
        "sequence": "MAANPSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALARSPLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLEAE",
        "proteome": "UP000051836",
        "gene": "AAES_119982",
        "go_terms": [
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006974",
                "name": "DNA damage response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0070876",
                "name": "SOSS complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "0bfa69b9358e2f5f65c4113428e8e73b4178c569",
        "counters": {
            "domain_architectures": 1296,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1296
        }
    }
}