GET /api/protein/unreviewed/A0A0M3TH35/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0M3TH35",
"id": "A0A0M3TH35_9ADEN",
"source_organism": {
"taxId": "38416",
"scientificName": "Simian adenovirus 19",
"fullName": "Simian adenovirus 19"
},
"name": "Pre-hexon-linking protein VIII",
"description": [
"Hexon-linking protein-C: Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together",
"Hexon-linking protein-N: Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together"
],
"length": 233,
"sequence": "MSKEIPTPYMWSYQPQMGLAAGAAQDYSSKMNWLSAGPHMISQVNDIRARRNQILLEQAAITSTPRRLLNPPSWPAARVYQETPAPTTVLLPRDAEAEVQMTNAGAQLAGGSRYVRYRGRSAPYPPGGIKRVFIRGRGIQLNDEVVRSSAGLRPDGVFQLGGAGRSSFTTRQAYLTLQSSSSQPRSGGIGTLQFVEEFVPSVYFNPFSGSPGRYPDSFIPNYDAVSESVDGYD",
"proteome": "UP000129765",
"gene": "L4",
"go_terms": [
{
"identifier": "GO:0031423",
"name": "hexon binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019028",
"name": "viral capsid",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "f20532aa3c92fe0868b9131ac7c10faaf42c982c",
"counters": {
"domain_architectures": 376,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"hamap": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 376
}
}
}