General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0H2WVT1",
        "id": "A0A0H2WVT1_SALPA",
        "source_organism": {
            "taxId": "295319",
            "scientificName": "Salmonella paratyphi A (strain ATCC 9150 / SARB42)",
            "fullName": "Salmonella paratyphi A (strain ATCC 9150 / SARB42)"
        },
        "name": "Thiosulfate reductase electron transfer subunit PhsB",
        "description": [
            "Component of the PhsABC thiosulfate reductase that catalyzes the reduction of thiosulfate to sulfite and hydrogen sulfide, with menaquinol as the sole electron donor. Proton motive force (PMF) is required to drive transmembrane electron transfer within the reductase. The PhsB subunit transfers electrons between PhsC and PhsA"
        ],
        "length": 223,
        "sequence": "MSCTRRQFITRVGALAAVSGMAGRVVANTLNINGVRYGMVHDESLCIGCTACMDACREVNNVPEGVSRLTIIRSEPQGTFPDVKYRFFRHSCQHCDHAPCVDVCPTGASFRDAASGIVDVNPDLCVGCQYCIAACPYRVRFIHPVSKTADKCDFCRKTNLKAGKQPACVESCPTKALTFGNLDDPNSDISRLLRQKTTYRYKLALGTKPKVYRVPFNYGEVSQ",
        "proteome": null,
        "gene": "nrfC",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "36fc3d2884af8d159f747c6748ebf5e0c70c5013",
        "counters": {
            "domain_architectures": 1445,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 2,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1445
        }
    }
}