General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0F6BAP9",
        "id": "A0A0F6BAP9_SALT1",
        "source_organism": {
            "taxId": "588858",
            "scientificName": "Salmonella typhimurium (strain 14028s / SGSC 2262)",
            "fullName": "Salmonella typhimurium (strain 14028s / SGSC 2262)"
        },
        "name": "Ascorbate-specific PTS system EIIB component",
        "description": [
            "The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II UlaABC PTS system is involved in ascorbate transport"
        ],
        "length": 101,
        "sequence": "MTVRILAVCGNGQGSSMIMKMKVDQFLTQSNIDHTVNSCAVGEYKSELSGADIIIASTHIAGEISVTGNKYVVGVRNMLSPADFGPKLLEVIKEHFPQDVK",
        "proteome": "UP000002695",
        "gene": "sgaB",
        "go_terms": [
            {
                "identifier": "GO:0008982",
                "name": "protein-N(PI)-phosphohistidine-sugar phosphotransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009401",
                "name": "phosphoenolpyruvate-dependent sugar phosphotransferase system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f3070428690adfd707457974133a19038f9498ce",
        "counters": {
            "domain_architectures": 24758,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "cdd": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 24758
        }
    }
}