GET /api/protein/unreviewed/A0A088FSC3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A088FSC3",
"id": "A0A088FSC3_9CAUD",
"source_organism": {
"taxId": "1541825",
"scientificName": "Shigella phage Shf125875",
"fullName": "Shigella phage Shf125875"
},
"name": "Lysis inhibition accessory protein",
"description": [
"Probably binds to the cytoplasmic part of the holin during lysis inhibition and stabilizes the holin-antiholin complex thereby resulting in a robust block of the hole formation"
],
"length": 82,
"sequence": "MIKQLQHALELQRHAWNNGHENYGASIDVEAEALEILQYFKHLNPAQADLRDVLAQKDELKYAKPLASAARKAVRHFVITLK",
"proteome": "UP000029363",
"gene": null,
"go_terms": [
{
"identifier": "GO:0140678",
"name": "molecular function inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "b2910fc5fc3c6a93686806f7f72e0317780a6cb3",
"counters": {
"domain_architectures": 253,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"hamap": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 253
}
}
}