General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A088FSC3",
        "id": "A0A088FSC3_9CAUD",
        "source_organism": {
            "taxId": "1541825",
            "scientificName": "Shigella phage Shf125875",
            "fullName": "Shigella phage Shf125875"
        },
        "name": "Lysis inhibition accessory protein",
        "description": [
            "Probably binds to the cytoplasmic part of the holin during lysis inhibition and stabilizes the holin-antiholin complex thereby resulting in a robust block of the hole formation"
        ],
        "length": 82,
        "sequence": "MIKQLQHALELQRHAWNNGHENYGASIDVEAEALEILQYFKHLNPAQADLRDVLAQKDELKYAKPLASAARKAVRHFVITLK",
        "proteome": "UP000029363",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0140678",
                "name": "molecular function inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "b2910fc5fc3c6a93686806f7f72e0317780a6cb3",
        "counters": {
            "domain_architectures": 253,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 253
        }
    }
}