GET /api/protein/unreviewed/A0A087XZ73/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A087XZ73",
        "id": "A0A087XZ73_POEFO",
        "source_organism": {
            "taxId": "48698",
            "scientificName": "Poecilia formosa",
            "fullName": "Poecilia formosa (Amazon molly)"
        },
        "name": "Interleukin",
        "description": [
            "Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells. Implicated in the generation and maintenance of T follicular helper (Tfh) cells and the formation of germinal-centers. Together with IL6, control the early generation of Tfh cells and are critical for an effective antibody response to acute viral infection. May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation"
        ],
        "length": 144,
        "sequence": "MLRGGPALATVFLCSVCLLAAPTPSRRNKLCSLGRIDKVKSLNDSLPTQMDLSLYTPSVEDYKKCPTAALSCFADELSVLCEEMMVSSLNCTEPKLSQSLRKLAKKFKKSESDCRLCELHLEKSPKDFLIVLLNVLQWINSENC",
        "proteome": "UP000028760",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005126",
                "name": "cytokine receptor binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006955",
                "name": "immune response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "2c83fdb06adf07ee63378586bb8cfd08fc88fa95",
        "counters": {
            "domain_architectures": 1651,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1651
        }
    }
}